Proteins Wiki
Advertisement

In the plant Arabidopsis thaliana, At1g01090.1 is a gene model for the locus At1g01090.[1]

Also known as PDH-E1 ALPHA, this gene model is classified by TAIR as "PDH-E1 ALPHA (PYRUVATE DEHYDROGENASE E1 ALPHA); pyruvate dehydrogenase (acetyl-transferring)". It is located on chr1, region 47705-49166 REVERSE.

Physiological function[]

At1g01090.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expression[]

At1g01090.1/Expression

Subcellular localization[]

At1g01090.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical properties[]

The gene model At1g01090.1 has 428 amino-acid residues and a molecular weight Mw = 47.173 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is 0.33, or 0.001 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotype[]

At1g01090.1/Knockout

Protein interactions[]

At1g01090.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structure[]

The gene model At1g01090.1 has 1 recognized domains:

  • Domain_0089_0393 E1_dh domain (PF00676, IPR001017) Description: Dehydrogenase, E1 component;Biological Process: metabolism (GO:0008152), Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor (GO:0016624)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequence[]

>At1g01090.1
MATAFAPTKL TATVPLHGSH ENRLLLPIRL APPSSFLGST RSLSLRRLNH SNATRRSPVV SVQEVVKEKQ STNNTSLLIT KEEGLELYED MILGRSFEDM CAQMYYRGKM FGFVHLYNGQ EAVSTGFIKL LTKSDSVVST YRDHVHALSK GVSARAVMSE LFGKVTGCCR GQGGSMHMFS KEHNMLGGFA FIGEGIPVAT GAAFSSKYRR EVLKQDCDDV TVAFFGDGTC NNGQFFECLN MAALYKLPII FVVENNLWAI GMSHLRATSD PEIWKKGPAF GMPGVHVDGM DVLKVREVAK EAVTRARRGE GPTLVECETY RFRGHSLADP DELRDAAEKA KYAARDPIAA LKKYLIENKL AKEAELKSIE KKIDELVEEA VEFADASPQP GRSQLLENVF ADPKGFGIGP DGRYRCEDPK FTEGTAQV
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignment[]

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structure[]

A predicted structure for this protein is available here.

References[]

  1. This is a test reference.

Further reading[]

General database links[]