FANDOM


In the plant Arabidopsis thaliana, At1g44880.1 is a gene model for the locus At1g44880.[1]

At1g44880.1/Header

Physiological functionEdit

At1g44880.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At1g44880.1/Expression

Subcellular localizationEdit

At1g44880.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

At1g44880.1/Biophysics_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At1g44880.1/Knockout

Protein interactionsEdit

At1g44880.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

At1g44880.1/Domains_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At1g44880.1
MTGSTSQEPS SQCDSNLPNR LFATDQYPRG RLNIYSRPDI LSFIRKVFQG TKELDFILQS CFGPLFHLPV SKCAMSGKLM HALLCTQLVT KKKYELWTVF GGYPLRFALP EFACVTGLPC GEFSEDYDPD DDPVYVDGMK SYWDELIGPD KTVTLGDVSD MLTNKRKTLS SDHRLKLAFL LIVDGVLIAS NQIGRPTFKY VEMLADLDKF LSFPWGRESF LKTVVGMRPD KRNLGKSTGK RQLTTDPIKS LVSQLQQKTF RLKGFPLALQ LIAFRNIPGL LDLVLDDSTS KTILLWKRLT HPKQVISHPQ IHALESNLKL PVDPLIVGDL NADQSWAEWD DEVKDKKVAH MYNLIWSSHQ FQKTDWPGGD ATLPPISVPK KKNSGVHKKH IVDRKKKLGV KSVAPKSKRR YSTRSKPELN LSDDEKSRLI SELQTKVEEL SNRVMKLEKA KKAVRFKRST KLSSSFVACS SRPKRKKTME VPIQSQTPQT SSQSHTLSEH VIGQPEVAQQ VPDDHLDKSQ DSSDSTPLIN TDDANEGNPV YDTDVKDQNA NEEDVDSQMQ VDASSNQSVE KLLPLNQDHI SDDASERVPA IPSGLDLSKE HNSTEQESNA NEEDAGSQMK VDPRSVPSVE KLLPINQNHI IDDASERVPA IPSGLDLSKE HNSAEQESNA NEEDADSQMK VDPRSVPSVE KLLPINQDHI IDDASDRVPA THSGLDLPKE HNSEEMQTNA NETDVDGKMQ DSLDRETASH SDIDLPIDQS FEEQQAKDTM EAAAASHSLL GFAKFANKKV TLESAAVSQV LSQSPPEVNF DGDPMKDQIN DSRDIGAHDL DENQEEGYVD VSDSSPARER GKPTLSEAEH MEVLVSLLSQ KLATTLTNQR AAFVQPWFAN HLQGKLKSFK AAKMKSRVKW SEPMKQFIVG PNTEWFADID TIYLPMIWDS KHWVGLAINL GVWSVEILDP NTDLYEEDER LDGLYKNLRY GDCGPVTMKF LEILASDNPP ENMAKITDKH VDSFSRKYAM DIYEEFVCPL YASDFSNK
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Community content is available under CC-BY-SA unless otherwise noted.