Proteins Wiki
Advertisement

In the plant Arabidopsis thaliana, At1g54780.1 is a gene model for the locus At1g54780.[1]

This gene model is classified by TAIR as "thylakoid lumen 18.3 kDa protein". It is located on chr1, region 20443200-20444620 FORWARD.

Physiological function[]

At1g54780.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expression[]

At1g54780.1/Expression

Subcellular localization[]

At1g54780.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical properties[]

The gene model At1g54780.1 has 285 amino-acid residues and a molecular weight Mw = 31.141 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is 3.33, or 0.012 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotype[]

At1g54780.1/Knockout

Protein interactions[]

At1g54780.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structure[]

The gene model At1g54780.1 has 1 recognized domains:

  • Domain_0105_0229 DUF477 domain (PF04536, IPR007621) Description: Protein of unknown function DUF477_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequence[]

>At1g54780.1
METLLSPRAL SPPLNPKPLS LHQTKPTSHS LSLSKPTTFS GPKHLSTRFT KPESRNWLID AKQGLAALAL SLTLTFSPVG TALASEFNIL NDGPPKETYV VDDAGVLSRV TKSDLKKLLS DLEYRKKLRL NFITVRKLTS KADAFEYADQ VLEKWYPSIE EGNNKGIVVL ITSQKEGAIT GGPAFIEAVG ENILDATVSE NLPVLATDEK YNEAVYSSAK RLVAAIDGQP DPGGPTVKDS KRESNFKTKE ETDEKRGQFS LVVGGLLVIA FVVPMAQYFA YVSRK
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignment[]

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structure[]

A predicted structure for this protein is available here.

References[]

  1. This is a test reference.

Further reading[]

General database links[]