Proteins Wiki
Advertisement

In the plant Arabidopsis thaliana, At2g26620.1 is a gene model for the locus At2g26620.[1]

At2g26620.1/Header

Physiological function[]

At2g26620.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expression[]

At2g26620.1/Expression

Subcellular localization[]

At2g26620.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical properties[]

At2g26620.1/Biophysics_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotype[]

At2g26620.1/Knockout

Protein interactions[]

At2g26620.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structure[]

At2g26620.1/Domains_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequence[]

>At2g26620.1
MACIAFVLKA LCLSLLLIVV ASRSTIRPKV FNVQRHGSKP DGKTDNTNAF TSIWSRACKR ISGSSKIYVP KGTFYLGGVE FVGPCKNPIE FIIDGTLLAP ANPNDIKQDT WINFRYINNL SISGSGTLDG QGKQSWPLND CHKNPNCPKL AISMGFAFVN NSNIKDITSL NSKMGHFNFF FVHHFNITGV TITAPSDSPN TDGIKMGSCS NIQISNTNIG TGDDCIAILS GTTKLNISNI NCGPGHGISV GSLGKNKDEK DVKDLFVRDV IFNGTSDGIR IKTWESSASK ILVSNFVYEN IQMIDVGKPI NIDQKYCPHP PCEHERKSHV QIQDLKLKNI YGTSKNKVAV NLQCSKSFPC KNVELIDINI KQNGLEDGSS ITVCENVDGF ARGKMFPQHC LN
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignment[]

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structure[]

A predicted structure for this protein is available here.

References[]

  1. This is a test reference.

Further reading[]

General database links[]

Advertisement