FANDOM


In the plant Arabidopsis thaliana, At2g31810.1 is a gene model for the locus At2g31810.[1]

This gene model is classified by TAIR as "acetolactate synthase small subunit, putative". It is located on chr2, region 13531348-13535323 FORWARD.

Physiological functionEdit

At2g31810.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g31810.1/Expression

Subcellular localizationEdit

At2g31810.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g31810.1 has 491 amino-acid residues and a molecular weight Mw = 53.879 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 7.90, or 0.016 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g31810.1/Knockout

Protein interactionsEdit

At2g31810.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g31810.1 has 2 recognized domains:

  • Domain_0087_0158 ACT domain (PF01842, IPR002912) Description: Amino acid-binding ACT;Biological Process: metabolism (GO:0008152), Molecular Function: amino acid binding (GO:0016597)
  • Domain_0320_0393 ACT domain (PF01842, IPR002912) Description: Amino acid-binding ACT;Biological Process: metabolism (GO:0008152), Molecular Function: amino acid binding (GO:0016597)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g31810.1
MAAISVSSSP SIRCLRSACS DSSPALVSST RVSFPAKISY LSGISSHRGD EMGKRMEGFV RSVDGKISDA SFSEASSATP KSKVRKHTIS VFVGDESGMI NRIAGVFARR GYNIESLAVG LNRDKALFTI VVCGTERVLQ QVIEQLQKLV NVLKVEDISS EPQVERELML VKVNAHPESR AEIMWLVDTF RARVVDIAEH ALTIEVTGDP GKMIAVERNL KKFQIREIVR TGKIALRREK MGATAPFWRF SAASYPDLKE QAPVSVLRSS KKGAIVPQKE TSAGGDVYPV EPFFDPKVHR ILDAHWGLLT DEDTSGLRSH TLSLLVNDIP GVLNIVTGVF ARRGYNIQSL AVGHAETKGI SRITTVIPAT DESVSKLVQQ LYKLVDVHEV HDLTHLPFSE RELMLIKIAV NAAARRDVLD IASIFRAKAV DVSDHTITLQ LTGDLDKMVA LQRLLEPYGI CEVARTGRVA LARESGVDSK YLRGYSFPLT G
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Community content is available under CC-BY-SA unless otherwise noted.