Proteins Wiki
Advertisement

In the plant Arabidopsis thaliana, At3g06350.1 is a gene model for the locus At3g06350.[1]

Also known as EMB3004, and MEE32, this gene model is classified by TAIR as "EMB3004/MEE32 (EMBRYO DEFECTIVE 3004, maternal effect embryo arrest 32); 3-dehydroquinate dehydratase/ NADP binding / shikimate 5-dehydrogenase". It is located on chr3, region 1924542-1927707 REVERSE.

Physiological function[]

At3g06350.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expression[]

At3g06350.1/Expression

Subcellular localization[]

At3g06350.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical properties[]

The gene model At3g06350.1 has 603 amino-acid residues and a molecular weight Mw = 65.792 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -2.57, or -0.004 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotype[]

At3g06350.1/Knockout

Protein interactions[]

At3g06350.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structure[]

The gene model At3g06350.1 has 3 recognized domains:

  • Domain_0096_0313 DHquinase_I domain (PF01487, IPR001381) Description: Dehydroquinase class I;Molecular Function: 3-dehydroquinate dehydratase activity (GO:0003855), Biological Process: aromatic amino acid family biosynthesis (GO:0009073)
  • Domain_0328_0408 Shikimate_dh_N domain (PF08501, IPR013708) Description: Shikimate dehydrogenase substrate binding, N-terminal
  • Domain_0440_0558 Shikimate_DH domain (PF01488, IPR006151) Description: Shikimate/quinate 5-dehydrogenase;Molecular Function: shikimate 5-dehydrogenase activity (GO:0004764), Cellular Component: cytoplasm (GO:0005737), Biological Process: aromatic amino acid family biosynthesis, shikimate pathway (GO:0016089)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequence[]

>At3g06350.1
MAASSTNARL TNPPRLLSKP RLSPTSVANL RFPAADFSTR FFADSSSPRL RSVPFPVVFS DQRRRRSMEP SNVYVASNST EMEIGSHDIV KNPSLICAPV MADSIDKMVI ETSKAHELGA DLVEIRLDWL KDFNPLEDLK TIIKKSPLPT LFTYRPKWEG GQYEGDENER RDVLRLAMEL GADYIDVELQ VASEFIKSID GKKPGKFKVI VSSHNYQNTP SVEDLDGLVA RIQQTGADIV KIATTAVDIA DVARMFHITS KAQVPTIGLV MGERGLMSRI LCSKFGGYLT FGTLDSSKVS APGQPTIKDL LDLYNFRRIG PDTKVYGIIG KPVSHSKSPI VHNQAFKSVD FNGVYVHLLV DNLVSFLQAY SSSDFAGFSC TIPHKEAALQ CCDEVDPLAK SIGAVNTILR RKSDGKLLGY NTDCIGSISA IEDGLRSSGD PSSVPSSSSP LASKTVVVIG AGGAGKALAY GAKEKGAKVV IANRTYERAL ELAEAIGGKA LSLTDLDNYH PEDGMVLANT TSMGMQPNVE ETPISKDALK HYALVFDAVY TPRITRLLRE AEESGAITVS GSEMFVRQAY EQFEIFTGLP APKELYWQIM SKY
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignment[]

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structure[]

A predicted structure for this protein is available here.

References[]

  1. This is a test reference.

Further reading[]

General database links[]