FANDOM


In the plant Arabidopsis thaliana, At3g21250.1 is a gene model for the locus At3g21250.[1]

Also known as ATMRP6, this gene model is classified by TAIR as "ATMRP6 (Arabidopsis thaliana multidrug resistance-associated protein 6)". It is located on chr3, region 7457674-7462497 REVERSE.

Physiological functionEdit

At3g21250.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At3g21250.1/Expression

Subcellular localizationEdit

At3g21250.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At3g21250.1 has 1294 amino-acid residues and a molecular weight Mw = 143.448 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is 2.42, or 0.002 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At3g21250.1/Knockout

Protein interactionsEdit

At3g21250.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At3g21250.1 has 4 recognized domains:

  • Domain_0123_0393 ABC_membrane domain (PF00664, IPR001140) Description: ABC transporter, transmembrane region;Molecular Function: ATP binding (GO:0005524), Biological Process: transport (GO:0006810), Cellular Component: integral to membrane (GO:0016021), Molecular Function: ATPase activity, coupled to transmembrane movement of substances (GO:0042626)
  • Domain_0467_0627 ABC_tran domain (PF00005, IPR003439) Description: ABC transporter related;Molecular Function: ATP binding (GO:0005524), Molecular Function: ATPase activity (GO:0016887)
  • Domain_0727_0996 ABC_membrane domain (PF00664, IPR001140) Description: ABC transporter, transmembrane region;Molecular Function: ATP binding (GO:0005524), Biological Process: transport (GO:0006810), Cellular Component: integral to membrane (GO:0016021), Molecular Function: ATPase activity, coupled to transmembrane movement of substances (GO:0042626)
  • Domain_1072_1255 ABC_tran domain (PF00005, IPR003439) Description: ABC transporter related;Molecular Function: ATP binding (GO:0005524), Molecular Function: ATPase activity (GO:0016887)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At3g21250.1
MSLLLLLCSW MNLRSSSAAA QDCSVTGLSD PLLTKNPRKE SARLATAGFF SILSFSWMNP LLSLGFKKPL SPEDIPSVVP EDEAQLAYKK FSQAWDTLLG DESSTKERNL VFRAVVKVYF KENIFIAVFA FLRTFAVVSL PLMLYVFVDY ANSDHRDLRN GFFNLACLVM LKLVESLTMR HWYFASRRSG MRIRSALMVA AYKKQLKLSS LGRKRHSSGE IVNYIAVDAY RMGEFLWWFH SGWSLSLQLL LSTAVLFGVV GAGAFPGLIL LLLCGLLNLP FAKMLQNCQT QFMIAQDKRL RSTSEILNSM KVIKLQSWED EFKKKIESCR DDEFTWLAKA QLTKAFGSFL YWMSPTIVSS VVFLGCALLK SAPLNASTIF TVLATLRVMS EPVKIIPDAI SAIIQGNVSF QRLNNFLLDD ELKMDEIERS GLDASGTAVD IQVGNFGWEP ETKIPTLRNI HLEIKHGQKV AVCGPVGAGK SSLLHAVLGE IPKVSGTVKV FGSIAYVSQT SWIQSGTIRD NILYGKPMES RRYNAAIKAC ALDKDMNGFG HGDLTEIGQR GINLSGGQKQ RIQLARAVYA DADVYLLDDP FSAVDAHTAG VLFHKCVEDS LKEKTVILVT HQVMEEGTIT QSGKYEELLM MGTAFQQLVN AHNDAVTVLP LASNESLGDL RKEGKDREIR NMTVVEKIEE EIEKTDIPGV QLTQEEEKES GYVGMKPFLD YIGVSRGWCL LWSSVLGQVG FVVFQAASTY WLAFAIGIPK ITNTMLIGVY SIISTLSAGF VYARAITTAH LGLKASKAFF SGFTNAVFKA PMLFFDSTPV GRILTRASSD LNVLDYDVPF AFIFVVAPAV ELTAALLIMT YVTWQVIIIA LLALAATKVV QDYYLASARE LIRINGTTKA PVMNYAAETS LGVVTIRAFG TAERFFKNYL NLVDADAVLF FLSNAAMEWV ILRIETLQNV TLFTCALLLI LIPKGYIAPG LVGLSLSYAL TLTQTQVFLT RWYCTLSNSI ISVERIKQYM NIPEEPPAII DDKRPPSSWP SNGTIHLQEL KIRYRPNAPL VLKGISCTFR EGTRVGVVGR TGSGKSTLIS ALFRLVEPAS GCILIDGIDI SKIGLKDLRM KLSIIPQEPT LFRGCIRTNL DPLGVYSDDE IWKALEKCQL KTTISNLPNK LDSSVSDEGE NWSVGQRQLF CLGRVLLKRN KILVLDEATA SIDSATDAII QRIIREEFAD CTVITVAHRV PTVIDSDMVM VLSFGDLVEY NEPSKLMETD SYFSKLVAEY WASCRGNSSQ NLQL
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Community content is available under CC-BY-SA unless otherwise noted.