Proteins Wiki
Advertisement

In the plant Arabidopsis thaliana, At5g51020.1 is a gene model for the locus At5g51020.[1]

This gene model is classified by TAIR as "similar to Protein of unknown function DUF1001 [Medicago truncatula] (GB:ABE80209.1); contains InterPro domain Protein of unknown function DUF1001; (InterPro:IPR010404)". It is located on chr5, region 20762786-20764391 REVERSE.

Physiological function[]

At5g51020.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expression[]

At5g51020.1/Expression

Subcellular localization[]

At5g51020.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical properties[]

The gene model At5g51020.1 has 269 amino-acid residues and a molecular weight Mw = 30.329 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -1.45, or -0.005 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotype[]

At5g51020.1/Knockout

Protein interactions[]

At5g51020.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structure[]

The gene model At5g51020.1 has 1 recognized domains:

  • Domain_0042_0236 DUF1001 domain (PF06206, IPR010404) Description: Protein of unknown function DUF1001_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequence[]

>At5g51020.1
MGTESGSDPE SSSNGWSRAR GLVVKTLVLI GGALLIKRLT KSTTRRDHAR VVSRSLTGEK FTREQASRDP DNYFNIRMLS CPAAEMVDGS EVLYLEQAFW RTPQKPFRQR LYMVKPCPKE LKCDVEVSSY AIRDAEEYKN FCDRPKDQRP LPEEVIGDIG EHLTTIHLNC CDRGKRCLYE GSTSPGGFPN SWNGASYCTS DLAVLKNNEI HLWDRGFDEN RNQVWGPKEG PYEFKPATSS SINENLSALN ILYQSSIDKP IQGSLILQD
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignment[]

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structure[]

A predicted structure for this protein is available here.

References[]

  1. This is a test reference.

Further reading[]

General database links[]